« Zurück
Home /
Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3(NDUFA3)

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3(NDUFA3)

Hersteller	Cusabio
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP015624HU-10
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Transport
Uniprot ID	O95167
Gene Names	NDUFA3
Organism	Homo sapiens (Human)
AA Sequence	AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLS PYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQ DPQGPSLEWLKKL
Expression Region	2-84aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	36.1 kDa
Alternative Name(s)	Complex I-B9 ; CI-B9NADH-ubiquinone oxidoreductase B9 subunit
Relevance	Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Reference	The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Subcellular Location	Mitochondrion inner membrane, Single-pass membrane protein
Protein Families	Complex I NDUFA3 subunit family
Paythway	OxidativePhosphorylation
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP015624HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen