« Zurück
Home /
Recombinant Human Nuclear transcription factor Y subunit beta(NFYB)

Recombinant Human Nuclear transcription factor Y subunit beta(NFYB)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP015774HU-500
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P25208
Gene Names	NFYB
Organism	Homo sapiens (Human)
AA Sequence	MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDT EDSMNDHEDTNGSKESFREQDIYLPIANVARIMKN AIPQTGKIAKDAKECVQECVSEFISFITSEASERC HQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQK FREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLP AGLITTDGQQQNVMVYTTSYQQISGVQQIQFS
Expression Region	1-207aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	49.8 kDa
Alternative Name(s)	CAAT box DNA-binding protein subunit B Nuclear transcription factor Y subunit B
Relevance	Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors.
Reference	"Intron-exon organization of the NF-Y genes. Tissue-specific splicing modifies an activation domain." Li X.-Y., Hooft van Huijsduijnen R., Mantovani R., Benoist C.O., Mathis D. J. Biol. Chem. 267:8984-8990(1992)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors.
Subcellular Location	Nucleus
Protein Families	NFYB/HAP3 subunit family
Paythway	Antigenprocessingandpresentation
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP015774HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen