« Zurück
Home /
Recombinant Human Homeobox protein Nkx-3.2(Nkx3-2)

Recombinant Human Homeobox protein Nkx-3.2(Nkx3-2)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-EP015849HU-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Alternative Name(s)	Bagpipe homeobox protein homolog 1 Homeobox protein NK-3 homolog B
AA Sequence	MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPA PGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSL LASPARTRTAVGQSAESPGGWDSDSALSEENEGRR RCADVPGASGTGRARVTLGLDQPGCELHAAKDLEE EAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVP GLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSR AAFSHAQVFELERRFNHQRYLSGPERADLAASLKL TETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKV AVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPY YCLPGWALSTCAAAAGTQ
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	P97503
Gene Names	Nkx3-2
Tag Info	N-terminal 10xHis-SUMO-tagged
Expression Region	1-333aa
MW of Fusion Proten	53, 7
Sequence Info	Full Length
Relevance	Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Reference	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)
Tag Information	N-terminal 10xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen