Vergleich

Recombinant Human Nucleoside diphosphate kinase, mitochondrial(NME4)

Hersteller Cusabio
Kategorie
Typ Proteins Recombinant
Specific against other
Format Liquid or Lyophilized powder
Menge 200ug
Host E.coli
ArtNr CSB-EP015889HU-200
Konjugat/Tag GST
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Research Topic
Signal Transduction
Uniprot ID
O00746
Gene Names
NME4
Organism
Homo sapiens (Human)
AA Sequence
SWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTL VGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSS GPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIR GDFSVHISRNVIHASDSVEGAQREIQLWFQSSELV SWADGGQHSSIHPA
Expression Region
1-187aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
44.3 kDa
Alternative Name(s)
Nucleoside diphosphate kinase D
Relevance
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis. Binds to anionic phospholipids, predominantly to cardiolipin; the binding inhibits its phosphotransfer activity. Acts as mitochondria-specific NDK; its association with cardiolipin-containing mitochondrial inner membrane is coupled to respiration suggesting that ADP locally regenerated in the mitochondrion innermembrane space by its activity is directly taken up via ANT ADP/ATP translocase into the matrix space to stimulate respiratory ATP regeneration. Proposed to increase GTP-loading on dynamin-related GTPase OPA1 in mitochondria. In vitro can induce liposome cross-linking suggesting that it can cross-link inner and outer membranes to form contact sites, and promotes intermembrane migration of anionic phosphoplipids. Promotes the redistribution of cardiolipin between the mitochondrial inner membrane and outer membrane which is implicated in pro-apoptotic signaling.
Reference
"nm23-H4, a new member of the family of human nm23/nucleoside diphosphate kinase genes localised on chromosome 16p13."
Milon L., Rousseau-Merck M.-F., Munier A., Erent M., Lascu I., Capeau J., Lacombe M.-L.
Hum. Genet. 99:550-557(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis
Subcellular Location
Mitochondrion intermembrane space, Peripheral membrane protein, Mitochondrion matrix
Protein Families
NDK family
Tissue Specificity
Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
Tag Information
N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen