« Zurück
Home /
Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial

Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial

Hersteller	Cusabio
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Colorectal Cancer Breast Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP016078HU-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Neuroscience
Uniprot ID	O14511
Gene Names	NRG2
Organism	Homo sapiens (Human)
AA Sequence	CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSS NSTREPPASGRVALVKVLDKWPLRSGGLQREQVIS VGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDT NGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGE KQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIK YGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDT VRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNG GVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYM PDPKQKAEELYQKR
Expression Region	112-405aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	48.8 kDa
Alternative Name(s)	Divergent of neuregulin-1 ; DON-1Neural- and thymus-derived activator for ERBB kinases ; NTAK
Relevance	Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.
Reference	Ligand discrimination in signaling through an ErbB4 receptor homodimer.Sweeney C., Lai C., Riese D.J. II, Diamonti A.J., Cantley L.C., Carraway K.L. IIIJ. Biol. Chem. 275:19803-19807(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.
Subcellular Location	Pro-neuregulin-2, membrane-bound isoform: Cell membrane, Single-pass type I membrane protein
Protein Families	Neuregulin family
Tissue Specificity	Restricted to the cerebellum in the adult.
Paythway	ErbBsignalingpathway
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen