« Zurück
Home /
Recombinant Human Odontogenic ameloblast-associated protein(ODAM)

Recombinant Human Odontogenic ameloblast-associated protein(ODAM)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP016268HU-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Signal Transduction
Target / Protein	ODAM
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	A1E959
AA Sequence	APLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPL NSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAG LLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQ PGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWE QPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLA EPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYL QKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQ TITPELPEEKDKTDSLREP
Tag Info	N-terminal 6xHis-tagged
Expression Region	16-279aa
Protein length	Full Length of Mature Protein
MW	33.2 kDa
Alternative Name(s)	Apin
Relevance	Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface.
References	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface.
Subcellular Location	Secreted, Cytoplasm, Nucleus
Protein Families	ODAM family
Tissue Specificity	Expressed in the junctional epithelium of healthy teeth. In periodontitis, absent in the pocket epithelium of the diseased periodontium but is detected in the gingival crevicular fluid.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen