Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
500ug |
Host |
E.coli |
ArtNr |
CSB-EP016268HU-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research areas |
Signal Transduction |
Target / Protein |
ODAM |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
A1E959 |
AA Sequence |
APLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPL NSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAG LLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQ PGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWE QPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLA EPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYL QKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQ TITPELPEEKDKTDSLREP |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
16-279aa |
Protein length |
Full Length of Mature Protein |
MW |
33.2 kDa |
Alternative Name(s) |
Apin |
Relevance |
Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface. |
References |
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface. |
Subcellular Location |
Secreted, Cytoplasm, Nucleus |
Protein Families |
ODAM family |
Tissue Specificity |
Expressed in the junctional epithelium of healthy teeth. In periodontitis, absent in the pocket epithelium of the diseased periodontium but is detected in the gingival crevicular fluid. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.