« Zurück
Home /
Recombinant Escherichia coli Peptide deformylase(def)

Recombinant Escherichia coli Peptide deformylase(def)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP017707ENV-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Others
Target / Protein	def
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Escherichia coli (strain K12)
Uniprot ID	P0A6K3
AA Sequence	SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMF ETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERL VLINPELLEKSGETGIEEGCLSIPEQRALVPRAEK VKIRALDRDGKPFELEADGLLAICIQHEMDHLVGK LFMDYLSPLKQQRIRQKVEKLDRLKARA
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	2-169aa
Protein Length	Full Length of Mature Protein
MW	35.2 kDa
Distributor Discount	50% off the list price
Alternative Name(s)	Polypeptide deformylase
Relevance	Roves the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.
Reference	Structural basis for the design of antibiotics targeting peptide deformylase.Hao B., Gong W., Rajagopalan P.T.R., Zhou Y., Pei D., Chan M.K.Biochemistry 38:4712-4719(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Removes the formyl group from the N-terminal Met of newly synthesized proteins
Protein Families	Polypeptide deformylase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen