« Zurück
Home /
Recombinant Staphylococcus aureus Peptide deformylase(def)

Recombinant Staphylococcus aureus Peptide deformylase(def)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	E.coli
ArtNr	CSB-EP017707FKZ-50
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Others
Target / Protein	def
Biologically active	Not Test
Expression system	E.coli
Species of origin	Staphylococcus aureus
Uniprot ID	P68826
AA Sequence	MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLI AMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISK RMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYL PTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDI QLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQ PHTDAVEV
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-183aa
Protein length	Full Length
MW	36.6 kDa
Alternative Name(s)	Polypeptide deformylase
Relevance	Roves the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions .
References	Staphylococcus aureus deformylase 1 encoding DNA.Lonetto M.A., Sylvester D.R., Warren R.L. Identification of Staphylococcus aureus proteins recognized by the antibody-mediated immune response to a biofilm infection.Brady R.A., Leid J.G., Camper A.K., Costerton J.W., Shirtliff M.E.Infect. Immun. 74:3415-3426(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions (By similarity).
Protein Families	Polypeptide deformylase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen