« Zurück
Home /
Recombinant Human Peroxisomal biogenesis factor 19(PEX19) (Active)

Recombinant Human Peroxisomal biogenesis factor 19(PEX19) (Active)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	E.coli
ArtNr	CSB-EP017802HU-50
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Tags & Cell Markers
Uniprot NO.	P40855
Gene Names	PEX19
Source	E.coli
Expression Region	2-296aa
Sequence	AAAEEGCSVGAEADRELEELLESALDDFDKAKPSP APPSTTTAPDASGPQKRSPGDTAKDALFASQEKFF QELFDSELASQATAEFEKAMKELAEEEPHLVEQFQ KLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNAT DLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQ SIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP PEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKA RFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLD ALNLSGPPGASGEQC
Protein Description	Full Length of Mature Protein
Tag Info	N-terminal GST-tagged
Mol. Weight	59.3 kDa
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 ug/ml can bind human PEX19, the EC50 of human PEX19 protein is 22.96-33.00 ug/ml.
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxin	Not test.
Storage Buffer	Tris-based buffer, 50% glycerol
Alias	33 kDa housekeeping protein Peroxin-19 Peroxisomal farnesylated protein
Relevance	Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen