« Zurück
Home /
Recombinant Human PHD finger protein 11(PHF11)

Recombinant Human PHD finger protein 11(PHF11)

Hersteller	Cusabio
Kategorie	Neuroscience Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	100ug
Host	E.coli
ArtNr	CSB-EP017900HU-100
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q9UIL8
Gene Names	PHF11
Organism	Homo sapiens (Human)
AA Sequence	MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLY SSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLK CKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQ SDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRG RKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDA TVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLM DETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEK KIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDL MSSSTSISSLSY
Expression Region	1-292aa
Sequence Info	Full Length of Isoform 2
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	60.5 kDa
Alternative Name(s)	BRCA1 C-terminus-associated protein Renal carcinoma antigen NY-REN-34
Relevance	Positive regulator of Th1-type cytokine gene expression.
Reference	Antigens recognized by autologous antibody in patients with renal-cell carcinoma. Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J. Int. J. Cancer 83:456-464(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Positive regulator of Th1-type cytokine gene expression.
Subcellular Location	Nucleus
Tissue Specificity	Highly expressed in T and B-cells, as well as natural killer and mature dendritic cells. Expressed at higher levels in Th1 as compared to Th2 cells. Expressed at low levels in all normal tissues tested, including lung, testis, small intestine, breast, liver and placenta.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen