Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
500ug |
Host |
E.coli |
ArtNr |
CSB-EP017900HU-500 |
Konjugat/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
Q9UIL8 |
Gene Names |
PHF11 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLY SSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLK CKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQ SDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRG RKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDA TVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLM DETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEK KIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDL MSSSTSISSLSY |
Expression Region |
1-292aa |
Sequence Info |
Full Length of Isoform 2 |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
60.5 kDa |
Alternative Name(s) |
BRCA1 C-terminus-associated protein Renal carcinoma antigen NY-REN-34 |
Relevance |
Positive regulator of Th1-type cytokine gene expression. |
Reference |
"Antigens recognized by autologous antibody in patients with renal-cell carcinoma." Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J. Int. J. Cancer 83:456-464(1999) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Positive regulator of Th1-type cytokine gene expression. |
Subcellular Location |
Nucleus |
Tissue Specificity |
Highly expressed in T and B-cells, as well as natural killer and mature dendritic cells. Expressed at higher levels in Th1 as compared to Th2 cells. Expressed at low levels in all normal tissues tested, including lung, testis, small intestine, breast, liver and placenta. |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.