Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
50ug |
Host |
E.coli |
ArtNr |
CSB-EP018202OEI-50 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
P79826 |
Gene Names |
plp |
Organism |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
AA Sequence |
PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDA RQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD |
Expression Region |
150-218aa |
Sequence Info |
Extracellular Domain |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
11.7 kDa |
Alternative Name(s) |
DM20Lipophilin |
Relevance |
This is the major myelin protein from the central nervous syst. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation. |
Reference |
Cloning and expression of the proteolipid protein DM20 cDNA from the brain of the rainbow trout, Oncorhynchus mykiss.Tang S., Panno J.P., McKeown B.A.Brain Res. Mol. Brain Res. 41:134-139(1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation. |
Subcellular Location |
Cell membrane, Multi-pass membrane protein |
Protein Families |
Myelin proteolipid protein family |
Tissue Specificity |
Central nervous system. Highest levels in spinal cord and medulla oblongata. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.