Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
200ug |
Host |
E.coli |
ArtNr |
CSB-EP018739RA-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
P13852 |
Gene Names |
Prnp |
Organism |
Rattus norvegicus (Rat) |
AA Sequence |
GGWNTGGSRYPGQGSPGGNRYPPQSGGTWGQPHGG GWGQPHGGGWGQPHGGGWGQPHGGGWSQGGGTHNQ WNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSA MSRPMLHFGNDWEDRYYRENMYRYPNQVYYRPVDQ YSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDV KMMERVVEQMCVTQYQKESQAYYDGRRS |
Expression Region |
29-231aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
26.3 kDa |
Alternative Name(s) |
CD230 |
Relevance |
May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu2+ or ZN2+ for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains . |
Reference |
Three-exon structure of the gene encoding the rat prion protein and its expression in tissues.Saeki K., Matsumoto Y., Hirota Y., Matsumoto Y., Onodera T.Virus Genes 12:15-20(1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Its primary physiological function is unclear. May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May promote myelin homeostasis through acting as a agonist for ADGRG6 receptor. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro) (By similarity). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu(2+) or ZN(2+) for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains (By similarity). |
Involvement in disease |
Found in high quantity in the brain of humans and animals infected with degenerative neurological diseases such as kuru, Creutzfeldt-Jakob disease (CJD), Gerstmann-Straussler syndrome (GSS), scrapie, bovine spongiform encephalopathy (BSE), transmissible mink encephalopathy (TME), etc. |
Subcellular Location |
Cell membrane, Lipid-anchor, GPI-anchor, Golgi apparatus |
Protein Families |
Prion family |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.