Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
1mg |
Host |
E.coli |
ArtNr |
CSB-EP019252HU-1 |
Konjugat/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Areas |
Epigenetics and Nuclear Signaling |
Uniprot ID |
O60671 |
Gene Names |
RAD1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIH FREHATCFATKNGIKVTVENAKCVQANAFIQAGIF QEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTL TALRMCYQGYGYPLMLFLEEGGVVTVCKINTQEPE ETLDFDFCSTNVINKIILQSEGLREAFSELDMTSE VLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLM EAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRT DNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES ES |
Expression Region |
1-282aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
58.8 kDa |
Alternative Name(s) |
DNA repair exonuclease rad1 homolog Rad1-like DNA damage checkpoint protein |
Relevance |
Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase. Isoform 1 possesses 3'->5' double stranded DNA exonuclease activity. |
Reference |
Human and mouse homologs of Schizosaccharomyces pombe rad1(+) and Saccharomyces cerevisiae RAD17: linkage to checkpoint control and mammalian meiosis. Freire R., Murguia J.R., Tarsounas M., Lowndes N.F., Moens P.B., Jackson S.P. Genes Dev. 12:2560-2573(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair |
Subcellular Location |
Nucleus |
Protein Families |
Rad1 family |
Tissue Specificity |
Expressed in testis, uterus, bladder, spleen, ovaries, lung, brain and muscle (at protein level). |
Paythway |
Cellularsenescence |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.