« Zurück
Home /
Recombinant Human Recoverin(RCVRN)

Recombinant Human Recoverin(RCVRN)

Hersteller	Cusabio
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP019519HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Neuroscience
Target / Protein	RCVRN
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P35243
AA Sequence	GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFL KDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFR SFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAF SLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLL PDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGT LANKEILRLIQFEPQKVKEKMKNA
Tag Info	N-terminal 6xHis-tagged
Expression Region	2-200aa
Protein length	Full Length of Mature Protein
MW	27.0 kDa
Alternative Name(s)	Cancer-associated retinopathy protein ; Protein CAR
Relevance	Ses to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.
References	Expression of a photoreceptor protein, recoverin, as a cancer-associated retinopathy autoantigen in human lung cancer cell lines.Matsubara S., Yamaji Y., Sato M., Fujita J., Takahara J.Br. J. Cancer 74:1419-1422(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.
Protein Families	Recoverin family
Tissue Specificity	Retina and pineal gland.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP019519HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen