« Zurück
Home /
Recombinant Rat Regenerating islet-derived protein 3-alpha(Reg3a)

Recombinant Rat Regenerating islet-derived protein 3-alpha(Reg3a)

Hersteller	Cusabio
Kategorie	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	100ug
Host	E.coli
ArtNr	CSB-EP019548RA-100
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Others
Target / Protein	Reg3a
Biologically active	Not Test
Expression system	E.coli
Species of origin	Rattus norvegicus (Rat)
Uniprot ID	P35231
AA Sequence	EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSW FQADLACQKRPSGHLVSILSGGEASFVSSLVTGRV NNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYL NWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVE LPFVCKFKQ
Tag Info	N-terminal 6xHis-tagged
Expression Region	26-174aa
Protein length	Full Length of Mature Protein
MW	20.5 kDa
Alternative Name(s)	Islet of Langerhans regenerating protein 3 ; REG 3Lithostathine 3; Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha ; Reg III-alpha
Relevance	Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway .
References	Identification of a second rat pancreatitis-associated protein. Messenger RNA cloning, gene structure, and expression during acute pancreatitis.Frigerio J.-M., Dusetti N.J., Keim V., Dagorn J.-C., Iovanna J.L.Biochemistry 32:9236-9241(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway (By similarity).
Involvement in disease	Overexpressed during the acute phase of pancreatitis.
Subcellular Location	Secreted
Tissue Specificity	Low expression found in healthy pancreas.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP019548RA-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen