« Zurück
Home /
Recombinant Rat Regucalcin(Rgn)

Recombinant Rat Regucalcin(Rgn)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP019630RA-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	Q03336
Gene Names	Rgn
Organism	Rattus norvegicus (Rat)
AA Sequence	MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIP SKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYV ATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDG KVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPD HSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTV DAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDV EGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKT TSCCFGGKDYSEMYVTCARDGMSAEGLLRQPDAGN IFKITGLGVKGIAPYSYAG
Expression Region	1-299aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 10xHis-SUMO-tagged
MW	51.9 kDa
Alternative Name(s)	Gluconolactonase (EC:3.1.1.17) Short name: GNL Senescence marker protein 30 Short name: SMP-30 Smp30
Relevance	Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca2+ signaling, and Ca2+-dependent cellular processes and enzyme activities.
Reference	"Senescence marker protein 30 functions as gluconolactonase in L-ascorbic acid biosynthesis, and its knockout mice are prone to scurvy." Kondo Y., Inai Y., Sato Y., Handa S., Kubo S., Shimokado K., Goto S., Nishikimi M., Maruyama N., Ishigami A. Proc. Natl. Acad. Sci. U.S.A. 103:5723-5728(2006)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities.
Subcellular Location	Cytoplasm
Protein Families	SMP-30/CGR1 family
Tissue Specificity	Detected in liver (at protein level). Hepatocytes and renal proximal tubular epithelium.
Tag Information	N-terminal 10xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen