« Zurück
Home /
Recombinant Human Regulator of G-protein signaling 5(RGS5)

Recombinant Human Regulator of G-protein signaling 5(RGS5)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	100ug
Host	E.coli
ArtNr	CSB-EP019657HU-100
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Signal Transduction
Uniprot ID	O15539
Gene Names	RGS5
Organism	Homo sapiens (Human)
AA Sequence	MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGD LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQ NNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKS PAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITM KNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEF YQELIK
Expression Region	1-181aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	47.9 kDa
Relevance	Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha
Reference	Genetic screens in yeast to identify mammalian nonreceptor modulators of G-protein signaling. Cismowski M.J., Takesono A., Ma C., Lizano J.S., Xie X., Fuernkranz H., Lanier S.M., Duzic E. Nat. Biotechnol. 17:878-883(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha (By similarity).
Subcellular Location	Isoform 1: Cytoplasm, Membrane, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen