« Zurück
Home /
Recombinant Human Rhodopsin(RHO),partial

Recombinant Human Rhodopsin(RHO),partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP019681HU-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P08100
Gene Names	RHO
Organism	Homo sapiens (Human)
AA Sequence	MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPW
Expression Region	1-36aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	20.2 kDa
Alternative Name(s)	Opsin-2
Relevance	Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal.
Reference	"Isolation and nucleotide sequence of the gene encoding human rhodopsin."Nathans J., Hogness D.S.Proc. Natl. Acad. Sci. U.S.A. 81:4851-4855(1984)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Photoreceptor required for image-forming vision at low light intensity
Involvement in disease	Retinitis pigmentosa 4 (RP4); Night blindness, congenital stationary, autosomal dominant 1 (CSNBAD1)
Subcellular Location	Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families	G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity	Rod shaped photoreceptor cells which mediate vision in dim light.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP019681HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen