« Zurück
Home /
Recombinant Human RING finger protein 114(RNF114)

Recombinant Human RING finger protein 114(RNF114)

Hersteller	Cusabio
Kategorie	Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	E.coli
ArtNr	CSB-EP019821HU-50
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	Q9Y508
Gene Names	RNF114
Organism	Homo sapiens (Human)
AA Sequence	MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEV YEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSA LAPGVRAVELERQIESTETSCHGCRKNFFLSKIRS HVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYT FPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPI CASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYD VDEEDMMNQVLQRSIIDQ
Expression Region	1-228aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	52.7 kDa
Alternative Name(s)	RING finger protein 114 Zinc finger protein 228 Zinc finger protein 313
Relevance	E3 ubiquitin-protein ligase promoting the ubiquitination and degradation of the CDK inhibitor CDKN1A and probably also CDKN1B and CDKN1C. These activities stimulate cell cycle's G1-to-S phase transition and suppress cellular senescence. May play a role in spermatogenesis.
Reference	"Identification of a novel human zinc finger protein gene ZNF313." Ma Y.-X., Zhang S., Hou Y., Huang X., Wu Q., Sun Y. Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35:230-237(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	E3 ubiquitin-protein ligase promoting the ubiquitination and degradation of the CDK inhibitor CDKN1A and probably also CDKN1B and CDKN1C. These activities stimulate cell cycle's G1-to-S phase transition and suppress cellular senescence. May play a role in spermatogenesis.
Subcellular Location	Cytoplasm, Nucleus
Tissue Specificity	Expressed in numerous tissues, including skin, CD4 lymphocytes and dendritic cells. Highest levels in testis.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen