Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
200ug |
Host |
E.coli |
ArtNr |
CSB-EP019872HU-200 |
Konjugat/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
Q495C1 |
Gene Names |
RNF212 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MANWVFCNRCFQPPHRTSCFSLTNCGHVYCDACLG KGKKNECLICKAPCRTVLLSKHTDADIQAFFMSID SLCKKYSRETSQILEFQEKHRKRLLAFYREKISRL EESLRKSVLQIEQLQSMRSSQQTAFSTIKSSVSTK PHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAA GPARISMISPPQDGRMGPHLTASFCFIPWLTLSKP PVPGECVISRGSPCFCIDVCPHWLLLLAFSSGRHG ELTNSKTLPIYAEVQRAVLFPFQQAEGTLDTFRTP AVSVVFPLCQFERKKSF |
Expression Region |
1-297aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
60.4 kDa |
Alternative Name(s) |
RING finger protein 212 |
Relevance |
SUMO E3 ligase that acts as a regulator of crossing-over during meiosis: required to couple chromosome synapsis to the formation of crossover-specific recombination complexes. Localizes to recombination sites and stabilizes meiosis-specific recombination factors, such as MutS-gamma complex proteins (MSH4 and MSH5) and TEX11. May mediate sumoylation of target proteins MSH4 and/or MSH5, leading to enhance their binding to recombination sites. Acts as a limiting factor for crossover designation and/or reinforcement and plays an antagonist role with CCNB1IP1/HEI10 in the regulation of meiotic recombination |
Reference |
"Targeted gene knockout reveals a role in meiotic recombination for ZHP-3, a Zip3-related protein in Caenorhabditis elegans." Jantsch V., Pasierbek P., Mueller M.M., Schweizer D., Jantsch M., Loidl J. Mol. Cell. Biol. 24:7998-8006(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
SUMO E3 ligase that acts as a regulator of crossing-over during meiosis |
Subcellular Location |
Nucleus, Chromosome |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.