« Zurück
Home /
Recombinant Artemisia vulgaris Non-specific lipid-transfer protein,partial

Recombinant Artemisia vulgaris Non-specific lipid-transfer protein,partial

Hersteller	Cusabio
Kategorie	Metabolism Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
ArtNr	CSB-EP020856AOH-50
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	P0C088
Gene Names	N/A
Organism	Artemisia vulgaris (Mugwort)
AA Sequence	ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGL ND
Expression Region	1-37aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	Tag-Free
MW	3.8 kDa
Alternative Name(s)	Pollen allergen Art v 3 Allergen: Art v 3
Relevance	Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues
Reference	"Lipid-transfer proteins as potential plant panallergens: cross-reactivity among proteins of Artemisia pollen, Castanea nut and Rosaceae fruits, with different IgE-binding capacities." Diaz-Perales A., Lombardero M., Sanchez-Monge R., Garcia-Selles F.J., Pernas M., Fernandez-Rivas M., Barber D., Salcedo G. Clin. Exp. Allergy 30:1403-1410(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).
Protein Families	Plant LTP family
Tag Information	Tag-Free

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen