« Zurück
Home /
Recombinant Human Signal-regulatory protein beta-1(SIRPB1),partial

Recombinant Human Signal-regulatory protein beta-1(SIRPB1),partial

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Neuroinflammation Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-EP021335HU-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Signal transduction
Uniprot ID	O00241
Gene Names	SIRPB1
Organism	Homo sapiens (Human)
AA Sequence	EDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGP IMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRN NLDFSISISNITPADAGTYYCVKFRKGSPDDVEFK SGAGTELSVRAKPSAPVVSGPAVRATPEHTVSFTC ESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSV SYSIHSTARVVLTRGDVHSQVICEIAHITLQGDPL RGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQV SNFYPRGLQLTWLENGNVSRTETASTLIENKDGTY NWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSY ALEISAHQKEHGSDITHEAALAPTAPL
Expression Region	30-371aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	41.3 kDa
Alternative Name(s)	Signal-regulatory protein beta-1 Short name:SIRP-beta-1 Alternative name(s): CD172 antigen-like family member B CD_antigen: CD172b
Relevance	Immunoglobulin-like cell surface receptor involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Participates also in the recruitment of tyrosine kinase SYK.
Reference	Paired receptor specificity explained by structures of signal regulatory proteins alone and complexed with CD47.Hatherley D., Graham S.C., Turner J., Harlos K., Stuart D.I., Barclay A.N.Mol. Cell 31:266-277(2008)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Immunoglobulin-like cell surface receptor involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Participates also in the recruitment of tyrosine kinase SYK.
Subcellular Location	Membrane, Single-pass type I membrane protein
Tissue Specificity	Detected in monocytes and dendritic cells.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen