« Zurück
Home /
Recombinant Human Sodium-dependent phosphate transport protein 2B(SLC34A2),partial

Recombinant Human Sodium-dependent phosphate transport protein 2B(SLC34A2),partial

Hersteller	Cusabio
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
ArtNr	CSB-EP021581HU-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	O95436
Gene Names	SLC34A2
Organism	Homo sapiens (Human)
AA Sequence	LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVS KFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSK CCEDLEEAQEGQDVPVKAPETFDNITISREAQGEV PASDSKTECTA
Expression Region	574-689aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-B2M-tagged
MW	27.1 kDa
Alternative Name(s)	Na(+)-dependent phosphate cotransporter 2B NaPi3b Sodium/phosphate cotransporter 2B
Relevance	May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.
Reference	"Regulation of the human sodium-phosphate cotransporter NaPi-IIb gene promoter by epidermal growth factor." Xu H., Collins J.F., Bai L., Kiela P.R., Ghishan F.K. Am. J. Physiol. 280:C628-C636(2001)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.
Involvement in disease	Pulmonary alveolar microlithiasis (PALM)
Subcellular Location	Membrane, Multi-pass membrane protein
Protein Families	SLC34A transporter family
Tissue Specificity	Highly expressed in lung. Also detected in pancreas, kidney, small intestine, ovary, testis, prostate and mammary gland. In lung, it is found in alveolar type II cells but not in bronchiolar epithelium.
Tag Information	N-terminal 6xHis-B2M-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen