Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Menge |
50ug |
Host |
E.coli |
ArtNr |
CSB-EP1079HU(F)-50 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Alternative Name(s) |
Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name: EGP Epithelial glycoprotein 314 Short name: EGP314 Short name: hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD_antigen: CD326 |
AA Sequence |
QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVI CSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDG LYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTD KDTEITCSERVRTYWIIIELKHKAREKPYDSKSLR TALQKEITTRYQLDPKFITSILYENNVITIDLVQN SSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDL TVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
Research Topic |
Tags & Cell Markers |
Uniprot ID |
P16422 |
Gene Names |
EPCAM |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
24-265aa |
MW of Fusion Proten |
43, 4 |
Sequence Info |
Partial |
Relevance |
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E. |
Reference |
"Molecular cloning and characterization of a human adenocarcinoma/epithelial cell surface antigen complementary DNA."Strnad J., Hamilton A.E., Beavers L.S., Gamboa G.C., Apelgren L.D., Taber L.D., Sportsman J.R., Bumol T.F., Sharp J.D., Gadski R.A.Cancer Res. 49:314-317(1989) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Species |
Homo sapiens (Human) |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.