« Zurück
Home /
Recombinant Triticum aestivum Non-specific lipid-transfer protein

Recombinant Triticum aestivum Non-specific lipid-transfer protein

Hersteller	Cusabio
Kategorie	Food Safety Allergenes Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Lipid & Fatty Acid Transport
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-EP2021TQN-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	P24296
Gene Names	N/A
Organism	Triticum aestivum (Wheat)
AA Sequence	DCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHN QARSQSDRQSACNCLKGIARGIHNLNEDNARSIPP KCGVNLPYTISLNIDCSRV
Expression Region	25-113aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	25.5 kDa
Alternative Name(s)	Phospholipid transfer protein Short name: PLTP
Relevance	Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
Reference	"Nucleotide sequence of a cDNA encoding a lipid transfer protein from wheat (Triticum durum Desf.)."Dieryck W., Gautier M.-F., Lullien V., Joudrier P.Plant Mol. Biol. 19:707-709(1992)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
Protein Families	Plant LTP family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP2021TQN-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen