« Zurück
Home /
Recombinant Tenebrio molitor Larval cuticle protein A1A

Recombinant Tenebrio molitor Larval cuticle protein A1A

Hersteller	Cusabio
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP304533TBF-10
Konjugat/Tag	Myc
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	P80681
Gene Names	N/A
Organism	Tenebrio molitor (Yellow mealworm beetle)
AA Sequence	GLVGAPATLSTAPIAYGGYGGYGAYGGSLLRAAPI ARVASPLAYAAPVARVAAPLAYAAPYARAAVAAPV AVAKTVVADEYDPNPQYSFGYDVQDGLTGDSKNQV ESRSGDVVQGSYSLVDPDGTRRTVEYTADPINGFN AVVHREPLVAKAVVAAPAIAKVHAPLAYSGGYLH
Expression Region	1-174aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged
MW	24.7 kDa
Alternative Name(s)	TM-LCP A1A Short name: TM-A1A
Relevance	Component of the cuticle of the larva of Tenebrio molitor
Reference	"Sequence studies of proteins from larval and pupal cuticle of the yellow meal worm, Tenebrio molitor."Andersen S.O., Rafn K., Roepstorff P.Insect Biochem. Mol. Biol. 27:121-131(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of the cuticle of the larva of Tenebrio molitor.
Tag Information	N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen