« Zurück
Home /
Recombinant Dendroaspis polylepis polylepis Toxin MIT1

Recombinant Dendroaspis polylepis polylepis Toxin MIT1

Hersteller	Cusabio
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Skin Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP326235DBI-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	P25687
Gene Names	N/A
Organism	Dendroaspis polylepis polylepis (Black mamba)
AA Sequence	AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVG TSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQT SPKKFKCLSKS
Expression Region	1-81aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	24.6 kDa
Alternative Name(s)	Short name: MIT 1 Alternative name(s): Black mamba intestinal toxin 1 Black mamba venom protein A
Relevance	Potently contracts gastrointestinal (GI) smooth muscle. The receptor for this toxin is present both in the CNS and in the smooth muscle and may be a potassium channel.
Reference	"MIT1, a black mamba toxin with a new and highly potent activity on intestinal contraction."Schweitz H., Pascaud P., Diochot S., Moinier D., Lazdunski M.FEBS Lett. 461:183-188(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2
Subcellular Location	Secreted
Protein Families	AVIT (prokineticin) family
Tissue Specificity	Expressed by the venom gland.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP326235DBI-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen