« Zurück
Home /
Recombinant Bacillus subtilis Penicillin-binding protein 3(pbpC),partial

Recombinant Bacillus subtilis Penicillin-binding protein 3(pbpC),partial

Hersteller	Cusabio
Kategorie	Food Safety Antibiotics Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP331705BRJ-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Microbiology
Target / Protein	pbpC
Biologically active	Not Test
Expression system	E.coli
Species of origin	Bacillus subtilis (strain 168)
Uniprot ID	P42971
AA Sequence	CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVK KEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDD QDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKT DDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRG QIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIK ELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKP DQEKLVSEAT
Tag Info	N-terminal 6xHis-tagged
Expression Region	21-240aa
Protein length	Partial
MW	29.2 kDa
Alternative Name(s)	PBP 3 Alternative name(s): PSPB20 Penicillin-binding protein C
References	"The complete genome sequence of the Gram-positive bacterium Bacillus subtilis."Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. Danchin A.Nature 390:249-256(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Cell membrane, Single-pass membrane protein
Protein Families	Transpeptidase family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen