Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Menge |
1mg |
Host |
E.coli |
ArtNr |
CSB-EP609HU-1 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Immunology |
Uniprot ID |
P09341 |
Gene Names |
CXCL1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHC AQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSD KSN |
Expression Region |
35-107aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
23.9 kDa |
Alternative Name(s) |
C-X-C motif chemokine 1 GRO-alpha(1-73) Melanoma growth stimulatory activity Short name: MGSA Neutrophil-activating protein 3 Short name: NAP-3 |
Relevance |
Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. |
Reference |
"Molecular characterization and chromosomal mapping of melanoma growth stimulatory activity, a growth factor structurally related to beta-thromboglobulin."Richmond A., Balentien E., Thomas H.G., Flaggs G., Barton D.E., Spiess J., Bordoni R., Francke U., Derynck R.EMBO J. 7:2025-2033(1988) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. |
Subcellular Location |
Secreted |
Protein Families |
Intercrine alpha (chemokine CxC) family |
Paythway |
Chemokinesignalingpathway |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.