Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
1mg |
Host |
E.coli |
ArtNr |
CSB-EP724336HU-1 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Areas |
Others |
Uniprot ID |
Q69384 |
Gene Names |
ERVK-6 |
Organism |
Homo sapiens (Human) |
AA Sequence |
LPMPAGAAAANYTYWAYVPFPPLIRAVTWMDNPTE VYVNDSVWVPGPIDDRCPAKPEEEGMMINISIGYH YPPICLGRAPGCLMPAVQNWLVEVPTVSPICRFTY HMVSGMSLRPRVNYLQDFSYQRSLKFRPKGKPCPK EIPKESKNTEVLVWEECVANSAVILQNNEFGTIID WAPRGQFYHNCSGQTQSCPSAQVSPAVDSDLTESL DKHKHKKLQSFYPWEWGEKGISTPRPKIVSPVSGP EHPELWRLTVASHHIRIWSGNQTLETRDRKPFYTI DLNSSLTVPLQSCVKPPYMLVVGNIVIKPDSQTIT CENCRLLTCIDSTFNWQHRILLVRAREGVWIPVSM DRPWEASPSVHILTEVLKGVLNRSKRFIFTLIAVI MGLIAVTATAAVAGVALHSSVQSVNFVNDWQKNST RLWNSQSSIDQKLANQINDLRQTVIWMGDRLMSLE HRFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHL QGREDNLTLDISKLKEQIFEASKAHLNLVPGTEAI AGVADGLANLNPVTWVKT |
Expression Region |
90-632aa |
Sequence Info |
Extracellular Domain |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
77.5 kDa |
Alternative Name(s) |
EnvK2 protein Envelope polyprotein HERV-K(C7) envelope protein HERV-K(HML-2.HOM) envelope protein HERV-K108 envelope protein HERV-K_7p22.1 provirus ancestral Env polyprotein Cleaved into the following 2 chains: Surface protein Short name: SU Transmembrane protein Short name: TM |
Relevance |
Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its original fusogenic properties. SU mediates receptor recognition. TM anchors the envelope heterodimer to the viral membrane through one transmembrane domain. The other hydrophobic domain, called fusion peptide, mediates fusion of the viral membrane with the target cell membrane |
Reference |
Identification of a Rev-related protein by analysis of spliced transcripts of the human endogenous retroviruses HTDV/HERV-K.Loewer R., Toenjes R.R., Korbmacher C., Kurth R., Loewer J.J. Virol. 69:141-149(1995) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its original fusogenic properties. |
Subcellular Location |
Transmembrane protein: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Surface protein: Cell membrane, Peripheral membrane protein |
Protein Families |
Beta type-B retroviral envelope protein family, HERV class-II K(HML-2) env subfamily |
Tissue Specificity |
Expressed in testis, and peripheral blood lymphocytes. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.