Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
500ug |
Host |
E.coli |
ArtNr |
CSB-EP726789MO-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Signal Transduction |
Uniprot ID |
Q62264 |
Gene Names |
Thrsp |
Organism |
Mus musculus (Mouse) |
AA Sequence |
MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPS LLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEV DHGLLPREEWQAKVAGNETSEAENDAAETEEAEED RISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTR KYQEMTGQVL |
Expression Region |
1-150aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
33.1 kDa |
Alternative Name(s) |
Spot 14 protein Short name: S14 Short name: SPOT14 |
Relevance |
Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB |
Reference |
"Cloning and initial characterization of human and mouse Spot 14 genes."Grillasca J.-P., Gastaldi M., Khiri H., Dace A., Peyrol N., Reynier P., Torresani J., Planells R.FEBS Lett. 401:38-42(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB (By similarity). |
Subcellular Location |
Nucleus, Cytoplasm |
Protein Families |
SPOT14 family |
Tissue Specificity |
Mainly expressed in tissues that synthesize triglycerides. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.