Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
500ug |
Host |
E.coli |
ArtNr |
CSB-EP822726HU-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
Q8N884 |
Gene Names |
MB21D1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
GASKLRAVLEKLKLSRDDISTAAGMVKGVVDHLLL RLKCDSAFRGVGLLNTGSYYEHVKISAPNEFDVMF KLEVPRIQLEEYSNTRAYYFVKFKRNPKENPLSQF LEGEILSASKMLSKFRKIIKEEINDIKDTDVIMKR KRGGSPAVTLLISEKISVDITLALESKSSWPASTQ EGLRIQNWLSAKVRKQLRLKPFYLVPKHAKEGNGF QEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCC RKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKT AFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCL RTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEY ERNNEFPVFDEF |
Expression Region |
161-522aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
58.3 kDa |
Alternative Name(s) |
Short name:cGAMP synthase Short name:cGAS Short name:h-cGAS Alternative name(s): 2'3'-cGAMP synthase Mab-21 domain-containing protein 1 |
Relevance |
Nucleotidyltransferase that catalyzes the formation of cyclic GMP-AMP (cGAMP) from ATP and GTP. Catalysis involves both the formation of a 2', 5' phosphodiester linkage at the GpA step and the formation of a 3', 5' phosphodiester linkage at the ApG step, producing c[G(2', 5')pA(3', 5')p]. Has antiviral activity by acting as a key cytosolic DNA sensor, the presence of double-stranded DNA (dsDNA) in the cytoplasm being a danger signal that triggers the immune responses. Binds cytosolic DNA directly, leading to activation and synthesis of cGAMP, a second messenger that binds to and activates TMEM173/STING, thereby triggering type-I interferon production. cGAMP can be transferred between cells by virtue of packaging within viral particles contributing to IFN-induction in newly infected cells in a cGAS-independent but TMEM173/STING-dependent manner (PubMed:26229115). |
Reference |
"Cyclic GMP-AMP synthase is a cytosolic DNA sensor that activates the type I interferon pathway."Sun L., Wu J., Du F., Chen X., Chen Z.J.Science 339:786-791(2013) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Nucleotidyltransferase that catalyzes the formation of cyclic GMP-AMP (cGAMP) from ATP and GTP |
Subcellular Location |
Cytoplasm, cytosol, Note=Upon transfection with dsDNA forms punctate structures that co-localize with DNA and Beclin-1 (BECN1) (PubMed:26048138), SUBCELLULAR LOCATION: |
Protein Families |
Mab-21 family |
Tissue Specificity |
Expressed in the monocytic cell line THP1. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.