« Zurück
Home /
Recombinant Human Protein MIS12 homolog(MIS12)

Recombinant Human Protein MIS12 homolog(MIS12)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP875639HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cell Biology
Uniprot ID	Q9H081
Gene Names	MIS12
Organism	Homo sapiens (Human)
AA Sequence	MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEV MQAVEQVILKKLDGIPDCDISPVQIRKCTEKFLCF MKGHFDNLFSKMEQLFLQLILRIPSNILLPEDKCK ETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLA ELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFR ESLVSLVQNSRKLQNIRDNVEKESKRLKIS
Expression Region	1-205aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	40.1 kDa
Relevance	Part of the MIS12 complex which is required for normal chromosome alignment and segregation and for kinetochore formation during mitosis.
Reference	Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Part of the MIS12 complex which is required for normal chromosome alignment and segregation and for kinetochore formation during mitosis
Subcellular Location	Chromosome, centromere, kinetochore
Protein Families	Mis12 family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen