« Zurück
Home /
Recombinant Human Oncostatin-M(OSM)

Recombinant Human Oncostatin-M(OSM)

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Glial Cell Markers
Typ	Proteins
Specific against	other
Menge	1mg
Host	E.coli
ArtNr	CSB-EP969HU-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Alternative Name(s)	Short name: OSM
AA Sequence	AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGF LQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNI EDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEP TKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHR FMHSVGRVFSKWGESPNRSRR
Research Topic	Stem Cells
Uniprot ID	P13725
Gene Names	OSM
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	26-221aa
MW of Fusion Proten	38, 2
Sequence Info	Full Length
Relevance	Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration
Reference	"Molecular cloning, sequence analysis, and functional expression of a novel growth regulator, oncostatin M."Malik N., Kallestad J.C., Gunderson N.L., Austin S.D., Neubauer M.G., Ochs V., Marquardt H., Zarling J.M., Shoyab M., Wei C.M., Linsley P.S., Rose T.M.Mol. Cell. Biol. 9:2847-2853(1989)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen