« Zurück
Home /
Recombinant Human Annexin A2(ANXA2)

Recombinant Human Annexin A2(ANXA2)

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Molecular Targets for Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins Lipoprotein Receptors & Associated Proteins By Organ Bladder Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	Mammalian cells
ArtNr	CSB-MP001840HU-10
Konjugat/Tag	Myc
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P07355
Gene Names	ANXA2
Organism	Homo sapiens (Human)
AA Sequence	STVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAE RDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDI AFAYQRRTKKELASALKSALSGHLETVILGLLKTP AQYDASELKASMKGLGTDEDSLIEIICSRTNQELQ EINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAK GRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVP KWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRK EVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGK GTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLY YYIQQDTKGDYQKALLYLCGGDD
Expression Region	2-339aa
Sequence Info	Full Length of Mature Protein
Source	Mammalian cell
Tag Info	N-terminal 6xHis-tagged
MW	42.5 kDa
Alternative Name(s)	Annexin II Annexin-2 Calpactin I heavy chain Calpactin-1 heavy chain Chromobindin-8 Lipocortin II Placental anticoagulant protein IV Short name: PAP-IV Protein I p36
Relevance	Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9 (PubMed:18799458, PubMed:24808179, PubMed:22848640).
Reference	"Two human 35KDA inhibitors of phospholipase A2 are related to substrates of pp60v-src and of the epidermal growth factor receptor/kinase."Huang K.-S., Wallner B.P., Mattaliano R.J., Tizard R., Burne C., Frey A., Hession C., McGray P., Sinclair L.K., Chow E.P., Browning J.L., Ramachandran K.L., Tang J., Smart J.E., Pepinsky R.B.Cell 46:191-199(1986)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9
Subcellular Location	Secreted, extracellular space, extracellular matrix, basement membrane, Melanosome
Protein Families	Annexin family
Tag Information	N-terminal 6xHis-Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP001840HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen