« Zurück
Home /
Recombinant Human C-X-C motif chemokine 10(CXCL10)

Recombinant Human C-X-C motif chemokine 10(CXCL10)

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Neuroinflammation Peptides & Proteins Recombinant Proteins Stem Cell Markers
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	Mammalian cells
ArtNr	CSB-MP006240HU-50
Konjugat/Tag	Myc
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Immunology
Uniprot ID	P02778
Gene Names	CXCL10
Organism	Homo sapiens (Human)
AA Sequence	VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQF CPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSK ERSKRSP
Expression Region	22-98aa
Sequence Info	Full Length of Mature Protein
Source	Mammalian cell
Tag Info	N-terminal 6xHis-tagged
MW	12.6 kDa
Alternative Name(s)	10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10 Small-inducible cytokine B10
Relevance	Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Reference	"Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins."Luster A.D., Unkeless J.C., Ravetch J.V.Nature 315:672-676(1985)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Subcellular Location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Paythway	Chemokinesignalingpathway
Tag Information	N-terminal 6xHis-Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP006240HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen