Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
50ug |
Host |
Mammalian cells |
ArtNr |
CSB-MP006240HU-50 |
Konjugat/Tag |
Myc |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Immunology |
Uniprot ID |
P02778 |
Gene Names |
CXCL10 |
Organism |
Homo sapiens (Human) |
AA Sequence |
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQF CPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSK ERSKRSP |
Expression Region |
22-98aa |
Sequence Info |
Full Length of Mature Protein |
Source |
Mammalian cell |
Tag Info |
N-terminal 6xHis-tagged |
MW |
12.6 kDa |
Alternative Name(s) |
10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10 Small-inducible cytokine B10 |
Relevance |
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. |
Reference |
"Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins."Luster A.D., Unkeless J.C., Ravetch J.V.Nature 315:672-676(1985) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. |
Subcellular Location |
Secreted |
Protein Families |
Intercrine alpha (chemokine CxC) family |
Paythway |
Chemokinesignalingpathway |
Tag Information |
N-terminal 6xHis-Myc-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.