« Zurück
Home /
Recombinant Human Lutropin-choriogonadotropic hormone receptor(LHCGR),partial

Recombinant Human Lutropin-choriogonadotropic hormone receptor(LHCGR),partial

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	20ug
Host	Mammalian cells
ArtNr	CSB-MP012911HU-20
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Cardiovascular
Uniprot ID	P22888
Gene Names	LHCGR
Organism	Homo sapiens (Human)
AA Sequence	EALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPV KVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDN LLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSIC NTGIRKFPDVTKVFSSESNFILEICDNLHITTIPG NAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTS LELKENVHLEKMHNGAFRGATGPKTLDISSTKLQA LPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEA TLTYPSHCCAFRNLPTKEQNFSHSISENFSKQCES TVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTP RCAPEPDAFNPCEDIMGYDFLR
Expression Region	27-363aa
Sequence Info	Partial
Source	Mammalian cell
Tag Info	N-terminal 6xHis-tagged
MW	41.6 kDa
Alternative Name(s)	Luteinizing hormone receptor Short name: LHR Short name: LSH-R
Relevance	Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Reference	Cloning and sequencing of human LH/hCG receptor cDNA.Minegish T., Nakamura K., Takakura Y., Miyamoto K., Hasegawa Y., Ibuki Y., Igarashi M.Biochem. Biophys. Res. Commun. 172:1049-1054(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for lutropin-choriogonadotropic hormone
Involvement in disease	Familial male precocious puberty (FMPP); Luteinizing hormone resistance (LHR)
Subcellular Location	Cell membrane, Multi-pass membrane protein
Protein Families	G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Tissue Specificity	Gonadal and thyroid cells.
Paythway	Calciumsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP012911HU-20-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen