« Zurück
Home /
Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial(SDHA),partial

Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial(SDHA),partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid
Menge	100ug
Host	E.coli
ArtNr	CSB-RP019854h-100
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Alternative Name(s)	Flavoprotein subunit of complex II ; Fp
AA Sequence	SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAF GLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGN MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPA AVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKG GQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVE YFALDLLMENGECRGVIALCIEDGSIHRIRAKNTV VATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQ DLEFV
Research Topic	Transport
Uniprot ID	P31040
Gene Names	SDHA
Tag Info	N-terminal GST-tagged
Expression Region	44-293aa
MW of Fusion Proten	54, 1
Sequence Info	Partial
Relevance	Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Can act as a tumor suppressor.
Reference	Compound heterozygous mutations in the flavoprotein gene of the respiratory chain complex II in a patient with Leigh syndrome.Parfait B., Chretien D., Roetig A., Marsac C., Munnich A., Rustin P.Hum. Genet. 106:236-243(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen