« Zurück
Home /
Recombinant Human Alpha-2-HS-glycoprotein(AHSG),partial

Recombinant Human Alpha-2-HS-glycoprotein(AHSG),partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	500ug
Host	E.coli
ArtNr	CSB-RP063694h(A4)-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Alternative Name(s)	Alpha-2-Z-globulin Ba-alpha-2-glycoprotein Fetuin-A
AA Sequence	PHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPW GYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTC HVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGK FSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTR VVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLP PSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGF CKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGA NEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPD
Research Topic	others
Uniprot ID	P02765
Gene Names	AHSG
Tag Info	N-terminal 6xHis-tagged
Expression Region	20-296aa
MW of Fusion Proten	33, 7
Sequence Info	Partial
Relevance	Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions.
Reference	"Haplotype analysis of the human alpha2-HS glycoprotein (fetuin) gene." Osawa M., Yuasa I., Kitano T., Henke J., Kaneko M., Udono T., Saitou N., Umetsu K. Ann. Hum. Genet. 65:27-34(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen