Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Menge |
500ug |
Host |
E.coli |
ArtNr |
CSB-RP063694h(A4)-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Alternative Name(s) |
Alpha-2-Z-globulin Ba-alpha-2-glycoprotein Fetuin-A |
AA Sequence |
PHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPW GYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTC HVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGK FSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTR VVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLP PSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGF CKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGA NEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPD |
Research Topic |
others |
Uniprot ID |
P02765 |
Gene Names |
AHSG |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
20-296aa |
MW of Fusion Proten |
33, 7 |
Sequence Info |
Partial |
Relevance |
Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions. |
Reference |
"Haplotype analysis of the human alpha2-HS glycoprotein (fetuin) gene." Osawa M., Yuasa I., Kitano T., Henke J., Kaneko M., Udono T., Saitou N., Umetsu K. Ann. Hum. Genet. 65:27-34(2001) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Species |
Homo sapiens (Human) |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.