« Zurück
Home /
Recombinant Human C-X-C chemokine receptor type 3(CXCR3)

Recombinant Human C-X-C chemokine receptor type 3(CXCR3)

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Neuroinflammation Peptides & Proteins Recombinant Proteins Stem Cell Markers
Typ	Proteins
Specific against	other
Menge	1mg
Host	Yeast
ArtNr	CSB-YP006253HU-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Alternative Name(s)	CKR-L2 G protein-coupled receptor 9 Interferon-inducible protein 10 receptor Short name: IP-10 receptor CD_antigen: CD183
AA Sequence	MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESD SCCTSPPCPQDFSLNFDRAFLPALYSLLFLLGLLG NGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLT LPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGAL LLACISFDRYLNIVHATQLYRRGPPARVTLTCLAV WGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQV GRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVS RGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDIL MDLGALARNCGRESRVDVAKSVTSGLGYMHCCLNP LLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSS SRRDSSWSETSEASYSGL
Research Topic	Cardiovascular
Uniprot ID	P49682
Gene Names	CXCR3
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-368aa
MW of Fusion Proten	42, 7
Sequence Info	Full Length
Relevance	Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway . Binds to CCL21. Probably promotes cell chemotaxis response.
Reference	"An alternatively spliced variant of CXCR3 mediates the inhibition of endothelial cell growth induced by IP-10, Mig, and I-TAC, and acts as functional receptor for platelet factor 4."Lasagni L., Francalanci M., Annunziato F., Lazzeri E., Giannini S., Cosmi L., Sagrinati C., Mazzinghi B., Orlando C., Maggi E., Marra F., Romagnani S., Serio M., Romagnani P.J. Exp. Med. 197:1537-1549(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen