« Zurück
Home /
Recombinant Mouse Monoglyceride lipase(Mgll)

Recombinant Mouse Monoglyceride lipase(Mgll)

Hersteller	Cusabio
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	Yeast
ArtNr	CSB-YP013787MO-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Cardiovascular
Uniprot ID	O35678
Gene Names	Mgll
Organism	Mus musculus (Mouse)
AA Sequence	MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYW KPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDM LVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVD TIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFS GMVLISPLVLANPESASTLKVLAAKLLNFVLPNMT LGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFG IQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSK GAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTN SVLHEVNSWVSHRIAAAGAGCPP
Expression Region	1-303aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	35.4 kDa
Alternative Name(s)	Short name: MGL Alternative name(s): Monoacylglycerol lipase Short name: MAGL
Relevance	Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (PubMed:9341166, PubMed:17700715, PubMed:18096503, PubMed:19029917, PubMed:20729846). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth (By similarity).
Reference	The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004).
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain
Subcellular Location	Cytoplasm, cytosol, Membrane, Peripheral membrane protein
Protein Families	AB hydrolase superfamily, Monoacylglycerol lipase family
Tissue Specificity	Ubiquitous.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen