Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
100ug |
Host |
Yeast |
ArtNr |
CSB-YP016078HU-100 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Areas |
Neuroscience |
Uniprot ID |
O14511 |
Gene Names |
NRG2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSS NSTREPPASGRVALVKVLDKWPLRSGGLQREQVIS VGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDT NGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGE KQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIK YGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDT VRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNG GVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYM PDPKQKAEELYQKR |
Expression Region |
112-405aa |
Sequence Info |
Extracellular Domain |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
34.8 kDa |
Alternative Name(s) |
Divergent of neuregulin-1 Short name: DON-1 Neural- and thymus-derived activator for ERBB kinases Short name: NTAK |
Relevance |
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor. |
Reference |
A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4.Higashiyama S., Horikawa M., Yamada K., Ichino N., Nakano N., Nakagawa T., Miyagawa J., Matsushita N., Nagatsu T., Taniguchi N., Ishiguro H.J. Biochem. 122:675-680(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor. |
Subcellular Location |
Pro-neuregulin-2, membrane-bound isoform: Cell membrane, Single-pass type I membrane protein |
Protein Families |
Neuregulin family |
Tissue Specificity |
Restricted to the cerebellum in the adult. |
Paythway |
ErbBsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.