Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
500ug |
Host |
Yeast |
ArtNr |
CSB-YP017640RA-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Areas |
Signal Transduction |
Uniprot ID |
P28840 |
Gene Names |
Pcsk1 |
Organism |
Rattus norvegicus (Rat) |
AA Sequence |
SVPRDSALNLFNDPMWNQQWYLQDTRMTASLPKLD LHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGE IAMQANNHKCGVGVAYNSKVGGIRMLDGIVTDAIE ASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQ KAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCD GYTDSIYTISISSASQQGLSPWYAEKCSSTLATSY SSGDYTDQRITSADLHNDCTETHTGTSASAPLAAG IFALALEANPNLTWRDMQHLVVWTSEYDPLANNPG WKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRN VPEKKECIIKDNNFEPRALKANGEVIVEIPTRACE GQENAINSLEHVQFEATIEYSRRGDLHVTLTSAAG TSTVLLAERERDTSPNGFKNWDFMSVHTWGENPVG TWTLKVTDMSGRMQNEGRIVNWKLILHGTSSQPEH MKQPRVYTSYNTVQNDRRGVEKMVNVVEEKPTQNS LNGNLLVPKNSSSSSVEDRRDEQVQGAPSKAMLRL LQSAFSKNTPSKQSSKIPSAKLSVPYEGLYEALEK LNKPSQLEDSEDSLYSDYVDVFYNTKPYKHRDDRL LQALMDILNEKN |
Expression Region |
111-752aa |
Sequence Info |
Full Length of Mature Protein |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
73.2 kDa |
Alternative Name(s) |
NEC 1 Alternative name(s): Prohormone convertase 1 Proprotein convertase 1 Short name: PC1 |
Relevance |
Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin, insulin and AGRP. |
Reference |
Isolation of two complementary deoxyribonucleic acid clones from a rat insulinoma cell line based on similarities to Kex2 and furin sequences and the specific localization of each transcript to endocrine and neuroendocrine tissues in rats.Hakes D.J., Birch N.P., Mezey A., Dixon J.E.Endocrinology 129:3053-3063(1991). |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin, insulin and AGRP. |
Subcellular Location |
Cytoplasmic vesicle, secretory vesicle |
Protein Families |
Peptidase S8 family, Furin subfamily |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.