« Zurück
Home /
Recombinant Human Semaphorin-7A(SEMA7A)

Recombinant Human Semaphorin-7A(SEMA7A)

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Renal Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	Yeast
ArtNr	CSB-YP021000HU-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cardiovascular
Uniprot ID	O75326
Gene Names	SEMA7A
Organism	Homo sapiens (Human)
AA Sequence	QGHLRSGPRIFAVWKGHVGQDRVDFGQTEPHTVLF HEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIG STKGSCLDKRDCENYITLLERRSEGLLACGTNARH PSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEG DEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVM QNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPE APLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAML VCSDAATNKNFNRLQDVFLLPDPSGQWRDTRVYGV FSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLP NPRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPM GPLKTPLFHSKYHYQKVAVHRMQASHGETFHVLYL TTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAA IQTMSLDAERRKLYVSSQWEVSQVPLDLCEVYGGG CHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINP AEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME SRHATYSWRHKENVEQSCEPGHQSPNCILFIENLT AQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEH LLGHACALA
Expression Region	45-648aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	70.4 kDa
Alternative Name(s)	CDw108 JMH blood group antigen John-Milton-Hargen human blood group Ag Semaphorin-K1 Short name: Sema K1 Semaphorin-L Short name: Sema L CD_antigen: CD108
Relevance	Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes.
Reference	"Semaphorin 7A promotes axon outgrowth through integrins and MAPKs."Pasterkamp R.J., Peschon J.J., Spriggs M.K., Kolodkin A.L.Nature 424:398-405(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes.
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor, Extracellular side
Protein Families	Semaphorin family
Tissue Specificity	Detected in skin keratinocytes and on endothelial cells from skin blood vessels (at protein level). Expressed in fibroblasts, keratinocytes, melanocytes, placenta, testis, ovary, spleen, brain, spinal chord, lung, heart, adrenal gland, lymph nodes, thymus, intestine and kidney.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen