« Zurück
Home /
Recombinant Mercurialis annua Profilin

Recombinant Mercurialis annua Profilin

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	Yeast
ArtNr	CSB-YP525079MQZ-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Allergen
Uniprot ID	O49894
Gene Names	N/A
Organism	Annual mercury
AA Sequence	MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIW AQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIA GTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVF GIYEEPVTPGQCNMVVERLGDYLIEQGM
Expression Region	1-133aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	16.3 kDa
Alternative Name(s)	Pollen allergen Mer a 1 Allergen: Mer a 1
Relevance	Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG
Reference	"Characterization of recombinant Mercurialis annua major allergen Mer a 1 (profilin)."Vallverdu A., Asturias J.A., Arilla M.C., Gomez-Bayon N., Martinez A., Martinez J., Palacios R.J. Allergy Clin. Immunol. 101:363-370(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity).
Subcellular Location	Cytoplasm, cytoskeleton
Protein Families	Profilin family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen