Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
100ug |
Host |
Yeast |
ArtNr |
CSB-YP839328HU-100 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Areas |
Signal Transduction |
Uniprot ID |
Q96GD0 |
Gene Names |
PDXP |
Organism |
Homo sapiens (Human) |
AA Sequence |
MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGER AVPGAPELLERLARAGKAALFVSNNSRRARPELAL RFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPD APGAVFVLGGEGLRAELRAAGLRLAGDPSAGDGAA PRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVA TDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALV VGKPSPYMFECITENFSIDPARTLMVGDRLETDIL FGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVP HYYVESIADLTEGLED |
Expression Region |
1-296aa |
Sequence Info |
Full Length |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
33.7 kDa |
Alternative Name(s) |
Short name: PLP phosphatase Alternative name(s): Chronophin |
Relevance |
Protein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho-tyrosine. Pyridoxal phosphate phosphatase. Has some activity towards pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PMP) and pyridoxine 5'-phosphate (PNP), with a highest activity with PLP followed by PNP. |
Reference |
Human pyridoxal phosphatase. Molecular cloning, functional expression, and tissue distribution.Jang Y.M., Kim D.W., Kang T.-C., Won M.H., Baek N.-I., Moon B.J., Choi S.Y., Kwon O.-S.J. Biol. Chem. 278:50040-50046(2003). |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Protein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho-tyrosine |
Subcellular Location |
Cytoplasm, cytosol, Cytoplasm, cytoskeleton, Cell projection, ruffle membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, lamellipodium membrane, Peripheral membrane protein, Cytoplasmic side, Cell membrane, Peripheral membrane protein, Cytoplasmic side |
Protein Families |
HAD-like hydrolase superfamily |
Tissue Specificity |
Ubiquitously expressed (at protein level) (PubMed:23223568). Highly expressed in all the regions of central nerve system except the spinal cord. Also expressed at high level in liver and testis. In fetus, it is weakly expressed in all organs except brain (PubMed:14522954, PubMed:15580268). |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.