« Zurück
Home /
Recombinant Human Growth/differentiation factor 2(GDF2)

Recombinant Human Growth/differentiation factor 2(GDF2)

Hersteller	Cusabio
Kategorie	Neuroscience Neuroinflammation Molecular Targets for Neuroscience Neural Development Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	1mg
Host	Yeast
ArtNr	CSB-YP892325HU-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cell Biology
Uniprot ID	Q9UK05
Gene Names	GDF2
Organism	Homo sapiens (Human)
AA Sequence	HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRV NFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVT PTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVL YKDDMGVPTLKYHYEGMSVAECGCR
Expression Region	300-429aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	16.3 kDa
Alternative Name(s)	Bone morphogenetic protein 9 Short name: BMP-9
Relevance	Potent circulating inhibitor of angiogenesis. Could be involved in bone formation. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.
Reference	"Bone morphogenetic protein-9 is a circulating vascular quiescence factor."David L., Mallet C., Keramidas M., Lamande N., Gasc J.M., Dupuis-Girod S., Plauchu H., Feige J.J., Bailly S.Circ. Res. 102:914-922(2008)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.
Involvement in disease	Telangiectasia, hereditary hemorrhagic, 5 (HHT5)
Subcellular Location	Secreted
Protein Families	TGF-beta family
Tissue Specificity	Detected in blood plasma (at protein level).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen