Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Menge |
10ug |
Host |
Yeast |
ArtNr |
CSB-YP892325HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Cell Biology |
Uniprot ID |
Q9UK05 |
Gene Names |
GDF2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRV NFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVT PTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVL YKDDMGVPTLKYHYEGMSVAECGCR |
Expression Region |
300-429aa |
Sequence Info |
Full Length of Mature Protein |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
16.3 kDa |
Alternative Name(s) |
Bone morphogenetic protein 9 Short name: BMP-9 |
Relevance |
Potent circulating inhibitor of angiogenesis. Could be involved in bone formation. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. |
Reference |
"Bone morphogenetic protein-9 is a circulating vascular quiescence factor."David L., Mallet C., Keramidas M., Lamande N., Gasc J.M., Dupuis-Girod S., Plauchu H., Feige J.J., Bailly S.Circ. Res. 102:914-922(2008) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. |
Involvement in disease |
Telangiectasia, hereditary hemorrhagic, 5 (HHT5) |
Subcellular Location |
Secreted |
Protein Families |
TGF-beta family |
Tissue Specificity |
Detected in blood plasma (at protein level). |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.