« Zurück
Home /
Recombinant Rat Allograft inflammatory factor 1(Aif1)

Recombinant Rat Allograft inflammatory factor 1(Aif1)

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Cytoskeleton Markers
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-EP001490RA-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Neuroscience
Uniprot ID	P55009
Gene Names	Aif1
Organism	Rattus norvegicus (Rat)
AA Sequence	SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPK YSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLK RMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDF LRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKK AISELP
Expression Region	2-147aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	32.7 kDa
Alternative Name(s)	Ionized calcium-binding adapter molecule 1; MRF-1; Microglia response factor
Relevance	Actin-binding protein that enhances mbrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation .
Reference	The genomic sequence and comparative analysis of the rat major histocompatibility complex.Hurt P., Walter L., Sudbrak R., Klages S., Mueller I., Shiina T., Inoko H., Lehrach H., Guenther E., Reinhardt R., Himmelbauer H.Genome Res. 14:631-639(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity).
Subcellular Location	Cytoplasm, cytoskeleton, Cell projection, ruffle membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, phagocytic cup
Tissue Specificity	Cardiac allograft, spleen and testis. Expressed by inflammatory cells (macrophages and neutrophils).
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen